A practical reference on Thiol: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-11-03. Anything still debated is marked as such rather than presented as settled.
Glutathione participates in detoxification reactions, amino acid transport, and the maintenance of protein thiols. It serves as a cofactor for several enzymes, including glutathione peroxidases and glutathione S-transferases. In research literature, altered glutathione status appears in studies of aging, infection, metabolic stress, and environmental exposure. Whether low glutathione is a cause, consequence, or marker of such conditions often remains unresolved. Direct measurement in blood or tissue provides a snapshot, but results depend on sample handling, timing, and the method used.
Glutathione is a small tripeptide made of glutamic acid, cysteine, and glycine. Its cysteine thiol group allows reversible oxidation and reduction, making it central to cellular redox chemistry. The reduced form, often abbreviated GSH, predominates inside most cells, while the oxidized disulfide form, GSSG, forms when two GSH molecules react. The ratio of GSH to GSSG is widely used as an indicator of oxidative stress in laboratory research, though it does not by itself diagnose a clinical condition.
Glutathione functions in redox balance, detoxification, and sulfur amino acid storage. It participates in reactions that help maintain ascorbate and protein thiol status. The molecule serves as a cofactor for several enzymes, including glutathione peroxidases and glutathione S-transferases. These enzymes reduce peroxides and conjugate electrophiles, respectively. Glutathione also contributes to the metabolism of xenobiotics and to the transport of cysteine between tissues. How interorgan transport and tissue-specific regulation shape whole-body pools remains an active area of study.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. Its cysteine residue carries a thiol group, which allows the molecule to participate in reduction and oxidation reactions. The compound exists in most living cells, where the reduced form, often abbreviated GSH, is usually more abundant than the oxidized disulfide form, GSSG. Intracellular concentrations are commonly in the millimolar range, while extracellular concentrations are much lower. This uneven distribution supports its role as a major cellular redox buffer.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C10H17N3O6S | Reduced glutathione (GSH); oxidized form differs by disulfide linkage. |
| Molar mass | 307.32 g/mol | Calculated for the reduced tripeptide. |
| Appearance | White to off-white crystalline powder | Typical laboratory reagent description. |
| Solubility | Soluble in water | Aqueous solutions are acidic; solubility depends on pH and salt form. |
| CAS Registry Number | 70-18-8 | Refers to reduced L-glutathione; oxidized form has a different number. |
Cells synthesize glutathione through two ATP-dependent steps: glutamate-cysteine ligase joins glutamate and cysteine, and glutathione synthetase adds glycine to form the complete tripeptide. Breakdown occurs through gamma-glutamyl transpeptidase and subsequent peptidase reactions, forming the gamma-glutamyl cycle. Within cells, glutathione also forms a disulfide-linked dimer called GSSG when two GSH molecules react. The balance between GSH and GSSG is widely used as an indicator of oxidative conditions, although the ratio can vary by compartment and tissue.
Glutathione supports several cellular processes beyond direct antioxidant action. It serves as a cofactor for glutathione peroxidase and glutathione S-transferase enzymes, which reduce peroxides and conjugate electrophiles, respectively. The molecule also acts as a reservoir of cysteine, an amino acid that can limit protein synthesis and redox signaling. In human nutrition, oral glutathione is sold as a supplement, but how much intact glutathione reaches tissues after ingestion remains an active research question. Clinical claims about supplementation are not uniformly supported by controlled trials.
Glutathione is a small tripeptide built from glutamic acid, cysteine, and glycine. Its peptide bond between glutamate and cysteine involves the gamma-carboxyl group rather than the usual alpha-carboxyl group. This structure gives the molecule a reactive thiol on the cysteine residue. The reduced form, often abbreviated GSH, is the predominant intracellular species in many cell types. Because the thiol can donate electrons, glutathione participates in redox chemistry and in the conjugation of reactive molecules.
Glutathione is a small tripeptide built from glutamate, cysteine, and glycine. The peptide bond between glutamate and cysteine uses the gamma-carboxyl group, a linkage that resists ordinary peptidases. Cells make it in two ATP-dependent steps: gamma-glutamylcysteine synthetase joins glutamate and cysteine, then glutathione synthetase adds glycine. The pathway is feedback-inhibited by glutathione itself, so intracellular levels tend to stay within a narrow range. Because cysteine is often limiting, sulfur amino acid supply influences how much glutathione a cell can produce.
In its reduced form, glutathione carries a sulfhydryl group that can donate electrons. This property lets it act as a major cellular antioxidant and redox buffer. Glutathione peroxidase uses it to reduce hydrogen peroxide and lipid peroxides, while glutathione reductase regenerates the reduced form using NADPH. The ratio of reduced glutathione to glutathione disulfide is widely used as an indicator of oxidative stress, though the ratio changes with compartment, cell type, and sample handling. Oxidized glutathione can also form mixed disulfides with proteins, affecting their activity.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. It occurs in nearly all living cells, with highest concentrations in liver, kidney, and red blood cells, and exists in reduced (GSH) and oxidized disulfide (GSSG) forms. The cysteine thiol group enables reversible oxidation and reduction reactions. This property makes glutathione a central participant in cellular redox balance. The balance between these forms is often used as an indicator of oxidative stress.
Glutathione synthesis proceeds in two ATP-dependent steps catalyzed by glutamate-cysteine ligase and glutathione synthetase. The first step joins glutamate and cysteine to form gamma-glutamylcysteine and is generally rate-limiting. The second step adds glycine to complete the tripeptide. Cysteine availability, feedback inhibition by glutathione, and oxidative conditions influence flux through this pathway. The pathway is conserved across many organisms, and degradation by gamma-glutamyl transpeptidase and related peptidases recycles amino acids for new synthesis.
Within cells, glutathione serves as a cofactor for glutathione peroxidases and glutathione S-transferases. These enzymes reduce hydrogen peroxide and organic peroxides or conjugate electrophilic compounds to the thiol group. The resulting conjugates can be exported and processed through mercapturic acid pathways. Glutathione also contributes to protein thiol homeostasis and to recycling of other antioxidants such as ascorbate. Its precise roles vary by tissue, and many regulatory effects observed in laboratory systems remain difficult to quantify in whole organisms.
==== Codon 72 variations ==== A common human polymorphism in TP53 involves a substitution of arginine for proline at codon 72 of exon 4. Numerous studies have explored the relationship between this variation and cancer susceptibility, yielding mixed results. For instance, a 2009 meta-analysis found no association between the codon 72 polymorphism and cervical cancer risk. Other studies have identified possible associations between the codon 72 polymorphism and various cancers. A 2011 study reported that the proline variant significantly increased pancreatic cancer risk in males. Another study found that proline homozygosity was associated with decreased breast cancer risk in Arab women. Additional research suggested that TP53 codon 72 polymorphisms, in combination with MDM2 SNP309 and A2164G, may affect susceptibility and age of onset for non-oropharyngeal cancers in women. A separate 2011 study linked the polymorphism to an increased risk of lung cancer in a Korean population. However, meta-analyses published in 2011 found no significant associations between the codon 72 variant and risks of either colorectal or endometrial cancer. A study of a Brazilian birth cohort found an association between the arginine variant and individuals without a family history of cancer. Meanwhile, another study reported that individuals with the homozygous Pro/Pro genotype had a significantly increased risk of renal cell carcinoma.
=== Fraud convictions === From 2017 to 2019, Cochran operated a $2.5 million Ponzi scheme, defrauding investors under the guise of a government contracting business. She persuaded at least 11 individuals to invest in her companies, Technology Management Solutions and Tactical Solutions Group, by falsely claiming she had lucrative government contracts. Instead of investing the funds, Cochran used the money for personal expenses, including purchasing real estate, jewelry, and a 1965 Shelby Cobra. She also used funds from new investors to pay partial returns to earlier investors, a hallmark of Ponzi schemes. One investor alone lost over $500,000 due to her fraudulent activities. Cochran pleaded guilty to wire fraud and money laundering on September 21, 2020, and was sentenced to 135 months in federal prison. She was also ordered to pay $2.5 million in restitution and forfeit assets obtained through her scheme.
===== Spironolactone ===== There is tentative support for spironolactone in women. Due to its feminising side effects and risk of infertility it is not often used by men. It can also cause low blood pressure, high blood potassium, and abnormal heart rhythms. Also, women who are pregnant or trying to become pregnant generally cannot use the medication as it is a teratogen, and can cause ambiguous genitalia in newborn children.
== Further reading == Whitten, Kenneth W.; Davis, Raymond E; Peck, M. Larry (2002). General chemistry. Fort Worth: Thomson Learning. ISBN 978-0-03-021017-4. Whitten, Kenneth W; Gailey, Kenneth D (1981). General chemistry. Philadelphia: Saunders College Pub. ISBN 978-0-03-057866-3. Petrucci, Ralph H.; Herring, F. Geoffrey; Madura, Jeffry; Bissonnette, Carey; Pearson (2017). General chemistry: principles and modern applications. Toronto: Pearson. ISBN 978-0-13-293128-1. Vogel, Arthur Israel; Furniss, B. S; Tatchell, Austin Robert (1978). Vogel's Textbook of practical organic chemistry. New York: Longman. ISBN 978-0-582-44250-4.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
Sources: en.wikipedia.org
immunostaining The use of an antibody conjugated to a chromophore or fluorophore to bind a specific antigen within a target substance (e.g. a protein) and thereby make the substance visible amidst a background of non-specific substances, allowing for detection of the target in a biological sample. The term originally referred to antibody-based staining of tissue sections with strong dyes or colorants, known as immunohistochemistry, but in modern usage encompasses a much broader range of laboratory methods united by their use of antibodies to label specific biomolecules with visually conspicuous compounds.
β-sheets are formed by H-bonds between an average of 5–10 consecutive amino acids in one portion of the chain with another 5–10 farther down the chain. The interacting regions may be adjacent, with a short loop in between, or far apart, with other structures in between. Every chain may run in the same direction to form a parallel sheet, or in the reverse direction to form an antiparallel sheet, or the chains may form a mixed sheet. The pattern of hydrogen bonding is different in the parallel and antiparallel configurations. Each amino acid in the interior strands of the sheet forms two H-bonds with neighboring amino acids, whereas each amino acid on the outside strands forms only one bond with an interior strand. Looking across the sheet at right angles to the strands, more distant strands are rotated slightly counterclockwise to form a left-handed twist. The Cα-atoms alternate above and below the sheet in a pleated structure, and the R side groups of the amino acids alternate above and below the pleats. The Φ and Ψ angles of the amino acids in sheets vary considerably in one region of the Ramachandran plot. It is more difficult to predict the location of β-sheets than of α-helices. The situation improves somewhat when the amino acid variation in multiple sequence alignments is taken into account.
Plane Poiseuille flow is flow created between two infinitely long parallel plates, separated by a distance h with a constant pressure gradient G = −dp/dx is applied in the direction of flow. The flow is essentially unidirectional because of infinite length. The Navier–Stokes equations reduce to
Red blood cell concentrates are produced either from whole blood or by apheresis. Production from whole blood is far more common than apheresis due to collection and production efficacy as well as economical purposes. When red blood cell concentrates are produced from whole blood, the whole blood is first separated through centrifugation (usually between 3000 to 5000 x g). The red blood cells are denser than plasma and the other present blood cells (platelets, white blood cells) and settle at the bottom of the blood bag. After centrifugation, the red blood cells are separated from the other components (the majority of the plasma, platelets and white blood cells) through the use of an extractor (also referred to as blood press). After extraction, an additive solution is usually added in a ratio of 1:1.5 to 1:2. The purpose of the additive solution is to maintain adequate viscosity, provide nutrients and ATP/GTP building blocks and reduce haemolysis generation throughout blood bank storage. Choice of additive solution has an impact on the red blood cell viability and, thereby, shelf life (expiry date) of the red blood cell concentrate. Usually, shelf life is limited to 4 to 6 weeks, provided that the red blood cell concentrates are stored in adequate conditions (2-6 °C). Commercial additive solutions are typically based on saline. They usually contain glucose, adenine, mannitol and, sometimes, phosphate and guanosine. The additive solution has no, or very little, buffering capacity, but buffering is provided by the red blood cells themselves.
Sources: en.wikipedia.org
=== Absorption === In mammals copper is absorbed in the stomach and small intestine, although there appear to be differences among species with respect to the site of maximal absorption. Copper is absorbed from the stomach and duodenum in rats and from the lower small intestine in hamsters. The site of maximal copper absorption is not known for humans, but is assumed to be the stomach and upper intestine because of the rapid appearance of 64Cu in the plasma after oral administration. Absorption of copper ranges from 15 to 97%, depending on copper content, form of the copper, and composition of the diet. Various factors influence copper absorption. For example, copper absorption is enhanced by ingestion of animal protein, citrate, and phosphate. Copper salts, including copper gluconate, copper acetate, and copper sulfate, are easily absorbed. copper oxides is not absorbed. Elevated levels of dietary zinc, as well as cadmium, high intakes of phytate and simple sugars (fructose, sucrose) inhibit dietary absorption of copper. Furthermore, low levels of dietary copper appear to inhibit iron absorption. Some forms of copper are not soluble in stomach acids and cannot be absorbed from the stomach or small intestine. Also, some foods may contain indigestible fiber that binds with copper. High intakes of zinc can significantly decrease copper absorption. Extreme intakes of vitamin C or iron can also affect copper absorption, reminding us of the fact that micronutrients need to be consumed as a balanced mixture.
=== Adobe ColdFusion 10 === ColdFusion 10 (Codenamed: Zeus) was released on May 15, 2012. New or improved features available in all editions (Standard, Enterprise, and Developer) include (but are not limited to):
== SB == Sb – (s) Antimony (Latin Stibium) SbA - Stibarsen, an alloy of antimony and arsenic SB (i) Sexy Bitch Sexy Bastard Sexy Boy (disambiguation) (s) Solomon Islands (ISO 3166 digram) (i) Special Warfare Boat Operator SBA (i) Santa Barbara Airport Simulation-Based Acquisition Small Business Administration Sovereign Base Area Student bar association SBB – (i) German for the Swiss Federal Railways SBC (i) Sensotronic Brake Control Single-Board Computer Southern Baptist Convention Sun Belt Conference (US college sports) SBCCOM – (p) U.S. Army Soldier and Biological Chemical Command (disbanded 2003) SBCS – (i) Single-Byte Character Set SBCT – (i) Stryker Brigade Combat Team SBD (s) Solomon Islands dollar (ISO 4217 currency code) Silent But Deadly SBP (i) Samahang Basketbol ng Pilipinas (Filipino, "Basketball Federation of the Philippines") U.S. School Breakfast Program Society of Business Practitioners State Bank of Pakistan SBS (i) Special Boat Service Special Broadcasting Service Seoul Broadcasting System SBW (i) Sonny Bill Williams (New Zealand dual-code rugby player)
Sources: en.wikipedia.org
GSH is the reduced form of glutathione, with a free thiol group on cysteine. GSSG is the oxidized disulfide form, created when two GSH molecules become linked. The two forms exist together, and their balance is often reported as the GSH/GSSG ratio in laboratory studies.
Glutathione is synthesized inside cells from amino acids rather than being classified as an essential dietary nutrient. Dietary sources can provide glutathione or its precursors, but digestion and absorption alter what reaches tissues. Research continues on how dietary intake relates to cellular glutathione levels.
The liver has high glutathione concentrations and uses the compound in conjugation and antioxidant reactions. These reactions are relevant to the processing of drugs, pollutants, and normal metabolic byproducts. Studies often examine liver glutathione as a marker of oxidative stress or detoxification capacity.
Glutathione is built from three amino acids: glutamate, cysteine, and glycine. The linkage involves the gamma-carboxyl group of glutamate rather than the alpha-carboxyl group, which is unusual for peptides. This structure protects the bond from some common peptidases.